Analytical Data
-
Gene name
MTCH1
- Application
-
Alternative Names
MTCH1; PSAP; CGI-64; UNQ1871/PRO4314; Mitochondrial carrier homolog 1; Presenilin-associated protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZJ7
-
Expression Region
1-389 aa
-
AA Sequence
MGASDPEVAPWARGGAAGMAGAGAGAGARGGAAAGVEARARDPPPAHRAHPRHPRPAAQP SARRMDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG SQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW KYLSVQGQLFRGSSLLFRRVSSGSCFALE
-
Molecular Weight
41.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTCH1, or mitochondrial carrier homolog 1, is a protein that plays a crucial role in mitochondrial function and cellular metabolism. It functions as a carrier protein, facilitating the transport of various metabolites across mitochondrial membranes, which is essential for energy production and metabolic homeostasis. Recent research has highlighted MTCH1's involvement in essential cellular processes, including apoptosis, mitochondrial dynamics, and oxidative stress response. Furthermore, studies have linked dysregulation of MTCH1 to several pathological conditions, including neurodegenerative diseases and metabolic disorders. Understanding the structural and functional characteristics of MTCH1 could provide insights into its role in these diseases and identify potential therapeutic targets. The exploration of MTCH1 recombinant protein holds promise for elucidating the molecular mechanisms underlying its action and the potential development of novel interventions for disorders associated with mitochondrial dysfunction. As a result, the investigation of MTCH1 not only advances our knowledge of mitochondrial biology but also opens avenues for innovative biomedical research.
