Cat: PA1000-2602

Recombinant Human QPRT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    QPRT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    QPRT;Nicotinate-nucleotide pyrophosphorylase [carboxylating]

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15274

  • Expression Region

    1-297aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMDAEGLALLLPPVTLAALVDSWLREDCPGL NYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEGSK LVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGW TGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG VEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELH PTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on QPRT (Quinolinate Phosphoribosyltransferase) has gained significant attention due to its role in the metabolism of tryptophan and its potential implications in various neurological disorders. QPRT is an enzyme that catalyzes the conversion of quinolinic acid, a neurotoxic metabolite, into nicotinamide adenine dinucleotide (NAD+), which is vital for cellular energy production and maintaining neuronal health. Dysregulation of QPRT activity can lead to elevated levels of quinolinic acid, which has been associated with neurodegenerative diseases such as Alzheimer's and Huntington's disease. Given the enzyme's critical function in the kynurenine pathway, researchers are investigating QPRT's structural properties and regulatory mechanisms to understand its therapeutic potential. Additionally, the enzyme's involvement in the immune response and neuroinflammation underscores the importance of QPRT in maintaining brain homeostasis. Insights gained from these studies could pave the way for the development of novel therapeutic strategies aimed at modulating QPRT activity, ultimately contributing to improved outcomes for patients with neurological disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US