Analytical Data
-
Gene name
MS4A8B
- Application
-
Alternative Names
MS4A8; 4SPAN4; MS4A8B; Membrane-spanning 4-domains subfamily A member 8; Four-span transmembrane protein 4; Membrane-spanning 4-domains subfamily A member 8B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BY19
-
Expression Region
1-250 aa
-
AA Sequence
MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQ PVQKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGS LSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNP GMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPP SYSSEIQANK
-
Molecular Weight
26.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MS4A8B, a member of the Membrane-Spanning 4-Domains Subfamily A (MS4A) family, has garnered attention in immunological research due to its potential role in regulating immune responses. This protein is primarily expressed in immune cells, including B cells and T cells, suggesting its involvement in adaptive immunity. Studies have indicated that MS4A8B may participate in cell signaling pathways that influence the activation and proliferation of lymphocytes. Furthermore, genetic variation in the MS4A gene cluster has been associated with several autoimmune diseases, including multiple sclerosis and systemic lupus erythematosus. This suggests a potential link between MS4A8B and the pathogenesis of these conditions. Understanding the structure and function of the MS4A8B recombinant protein could provide insights into its precise role in immune regulation and its implications for disease. Recent advancements in recombinant protein technology have enabled the production and characterization of MS4A8B, allowing for detailed studies of its molecular interactions and functional properties. This research could pave the way for novel therapeutic strategies targeting MS4A8B-related pathways in autoimmune diseases, contributing to improved patient outcomes and advancements in immunology. Thus, investigating MS4A8B not only enhances our understanding of its biological functions but also holds promise for future clinical applications.











