Analytical Data
-
Gene name
MS4A5
- Application
-
Alternative Names
MS4A5; CD20L2; TETM4; Membrane-spanning 4-domains subfamily A member 5; CD20 antigen-like 2; Testis-expressed transmembrane protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3V2
-
Expression Region
1-200 aa
-
AA Sequence
MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIM TFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIM NFLSALGAIAGIILLTFGFILDQNYICGYSHQNSQCKAVTVLFLGILITLMTFSIIELFI SLPFSILGCHSEDCDCEQCC
-
Molecular Weight
22.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MS4A5, a member of the membrane-spanning 4-domains A (MS4A) family, has garnered significant attention in recent years due to its potential role in various biological processes, particularly in immune regulation. This protein is primarily expressed in immune cells and has been implicated in the modulation of immune responses and inflammation. Studies have shown that MS4A5 might be involved in conditions such as autoimmune diseases and allergies, highlighting its potential as a therapeutic target. The relevance of MS4A5 in human health is underscored by its association with genetic polymorphisms linked to immune-related traits. Research efforts have focused on characterizing the structural and functional aspects of MS4A5, particularly through the production of recombinant proteins for experimental purposes. These studies aim to elucidate the specific mechanisms by which MS4A5 contributes to immune modulation and to explore its potential as a biomarker for disease susceptibility or progression. Understanding the role of MS4A5 in immune processes could pave the way for novel therapeutic strategies, making it a compelling subject for ongoing research in immunology and related fields.
