Analytical Data
-
Gene name
PTPN4
- Application
-
Alternative Names
PTPN4;Tyrosine-Protein phosphatase non-receptor type 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29074
-
Expression Region
655-913aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMVLTQFDQLYRKKPGMTMSCAKLPQNISKN RYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHT CTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTC HSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDF VCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDI VRTMRDQRAMMIQTPSQYRFVCEAILKVYE
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPN4, also known as Protein Tyrosine Phosphatase Non-Receptor Type 4, is a member of the protein tyrosine phosphatase family, which plays a crucial role in various cellular processes by regulating tyrosine phosphorylation levels. This regulation influences signaling pathways related to cell growth, differentiation, and immune response. Recent studies have highlighted the involvement of PTPN4 in multiple diseases, including cancer, where its expression levels can significantly affect tumor progression and metastasis. Additionally, PTPN4 has been implicated in autoimmune disorders, suggesting its potential role in modulating immune responses. Researchers are increasingly interested in recombinant PTPN4 for its therapeutic potential, as understanding its structure and function may lead to the development of targeted treatments that can modulate its activity. The generation of recombinant PTPN4 allows for in-depth functional studies, enzymatic assays, and structural analysis, providing insights into its mechanism of action. Recent advancements in recombinant protein technology have made it feasible to produce PTPN4 in heterologous systems, facilitating the study of its properties and interactions at a molecular level. These findings not only enhance our understanding of PTPN4's biological roles but also pave the way for potential applications in precision medicine aimed at diseases where PTPN4 is deregulated. Continued investigation into PTPN4 could reveal novel therapeutic targets and strategies for diseases characterized by altered tyrosine phosphorylation, making it a protein of significant interest in biomedical research.











