Cat: PA2000-957DB

Recombinant Human GBP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GBP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GBP1;Guanylate-binding Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P32455

  • Expression Region

    1-592aa

  • AA Sequence

    MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTG KSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEG LGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTH RIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDE YLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQL EKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESL QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQ EASSDRCSGLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEE PRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQ ASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTL ALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS

  • Molecular Weight

    91 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GBP1 (Guanylate-Binding Protein 1) is a member of the GBP family, which plays a crucial role in the innate immune response, particularly in the defense against viral and intracellular bacterial infections. It is characterized by its ability to bind to guanosine triphosphate (GTP) and its function as an interferon-induced protein, highlighting its importance in host-pathogen interactions. Research has shown that GBP1 is involved in various cellular processes, including protein synthesis, cell proliferation, and the modulation of inflammatory responses. The protein's role in autophagy and the regulation of cellular apoptosis further emphasizes its significance in immune signaling pathways. Given its diverse functions, GBP1 has garnered attention in the fields of immunology, virology, and cancer research, particularly concerning its potential as a therapeutic target. Studies have indicated that manipulating GBP1 expression can influence the outcome of infections and tumor progression, making it a promising candidate for therapeutic interventions. Understanding the molecular mechanisms underpinning GBP1's actions will not only advance our knowledge of innate immunity but may also pave the way for novel treatment strategies for infectious diseases and malignancies. As the scientific community continues to unravel the complexities of GBP1, its implications for vaccine development and the enhancement of immune responses against various pathogens are of particular interest, potentially leading to innovative approaches in immunotherapy and vaccine design.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US