Analytical Data
-
Gene name
MRS2L
- Application
-
Alternative Names
MRS2; HPT; MRS2L; Magnesium transporter MRS2 homolog. mitochondrial; MRS2-like protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HD23
-
Expression Region
1-117 aa
-
AA Sequence
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS
-
Molecular Weight
38.61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRS2L is a member of the mitochondrial potassium transporter family, playing a crucial role in maintaining mitochondrial homeostasis and cellular function. Research has indicated that MRS2L is involved in the regulation of mitochondrial membrane potential and intracellular calcium levels, which are vital for proper energy metabolism and apoptosis. Given the increasing recognition of mitochondrial dysfunction in various diseases, including neurodegenerative disorders and metabolic syndromes, MRS2L has garnered attention as a potential therapeutic target. Recent studies suggest that the manipulation of MRS2L activity may influence mitochondrial health and therefore provide insights into novel approaches for disease treatment. Understanding the structure and function of MRS2L through recombinant protein studies can elucidate its mechanism of action and interaction with other mitochondrial components, potentially leading to advancements in mitochondrial-targeted therapies. Additionally, the characterization of MRS2L’s role in cellular signaling pathways could further enhance our understanding of its contribution to health and disease, emphasizing the need for comprehensive research on this intriguing protein.
