Cat: PA2000-954DB

Recombinant Human OGC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OGC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OGC;SLC20A4;Mitochondrial 2-oxoglutarate/malate carrier Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q02978

  • Expression Region

    1-314aa

  • AA Sequence

    MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQ LSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLG IYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTAD GRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLA SYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNM RMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL EQMNKAYKRLFLSG

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of OGC (ornithine transcarbamylase) recombinant proteins is pivotal in understanding metabolic disorders, particularly those associated with urea cycle deficiencies. OGC plays a crucial role in the conversion of ornithine and carbamoyl phosphate into citrulline, a key step in the urea cycle that detoxifies ammonia in the liver. Mutations in the OTC gene, which encodes OGC, lead to hyperammonemia and can result in severe neurological damage or even mortality if left untreated. Recombinant OGC proteins are vital for developing novel therapeutic strategies, including enzyme replacement therapies and gene therapy approaches, aimed at correcting the underlying genetic deficiencies. Furthermore, producing OGC in a recombinant form allows for detailed structural and functional studies, which facilitate the design of small molecules or substrates that can enhance its activity or stability. Thus, research involving OGC recombinant proteins not only advances our understanding of urea cycle disorders but also opens avenues for innovative treatments, ultimately improving patient outcomes in conditions stemming from urea cycle dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US