Analytical Data
-
Gene name
PTGES2
- Application
-
Alternative Names
PTGES2;C9orf15;PGES2;Prostaglandin E synthase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NHH0
-
Expression Region
1-206aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKAVNEQGKEVTEFGNKYWLMLNEKEAQQV YGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFG AVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKD RPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAIT EASPAH
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTGES2, also known as prostaglandin E synthase 2, is an enzyme that plays a crucial role in the biosynthesis of prostaglandin E2 (PGE2), a potent lipid mediator involved in various physiological processes, including inflammation, pain, and tumorigenesis. The study of PTGES2 has garnered significant attention due to its implications in cancer biology, as elevated levels of PGE2 are often associated with tumor progression and metastasis. Research has indicated that PTGES2 expression is upregulated in several malignancies, including colorectal, breast, and lung cancers. This overexpression can lead to enhanced PGE2 production, promoting inflammation, immune evasion, and improved cell survival. As such, PTGES2 is being investigated as a potential therapeutic target, with efforts aimed at developing inhibitors that could block its activity and reduce PGE2 levels in the tumor microenvironment. Additionally, understanding the molecular mechanisms governing PTGES2 regulation could provide insights into its functional roles in cancer and other diseases. Overall, the exploration of PTGES2 and its recombinant protein forms is essential for advancing our knowledge of its contributions to disease pathogenesis and for the development of novel therapeutic strategies.











