Analytical Data
-
Gene name
MRPS33
- Application
-
Alternative Names
Small ribosomal subunit protein mS33. 28S ribosomal protein S33. mitochondrial. MRP-S33. S33mt
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y291
-
Expression Region
1-106 aa
-
AA Sequence
MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS33, a gene encoding a mitochondrial ribosomal protein, has garnered attention in molecular biology due to its potential role in mitochondrial function and protein synthesis. Mitochondria, often termed the powerhouses of the cell, are essential for energy production and are implicated in various metabolic processes and diseases. Abnormalities in mitochondrial function can lead to a range of disorders, including neurodegenerative diseases and metabolic syndromes. Recent studies have suggested that MRPS33 is not only crucial for the assembly and function of mitochondrial ribosomes but may also play a role in regulating apoptosis and reactive oxygen species production. Understanding the structure and function of MRPS33 as a recombinant protein provides insights into its interaction with other mitochondrial components, thereby illuminating its role in mitochondrial biology. Additionally, elucidating the mechanisms by which MRPS33 contributes to mitochondrial protein synthesis could reveal therapeutic targets for diseases related to mitochondrial dysfunction. As research progresses, characterizing MRPS33 and its functional implications presents significant opportunities for advancing our knowledge of mitochondrial dynamics and their impact on human health.
