Cat: PA1000-2573

Recombinant Human PSTPIP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSTPIP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSTPIP1;CD2BP1;Proline-serine-threonine phosphatase-interacting Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43586

  • Expression Region

    1-416aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMMPQLQFKDAFWCRDFTAHTGYEVLLQ RLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEINSLRASF DSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQ KSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKA RQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTIL RNALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTE PPAPVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPKTTSLAAS AASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDE LDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSTPIP1, or Proline Serine Threonine Phosphatase Interacting Protein 1, is an important protein implicated in a range of cellular processes, including cytoskeletal organization and cellular signaling pathways. Originally identified in immune cells, PSTPIP1 plays a critical role in mediating interactions between the actin cytoskeleton and various signaling molecules. Mutations or dysregulation of PSTPIP1 have been linked to several pathological conditions, such as autoinflammatory diseases, most notably the systemic autoinflammatory disease called PAPA syndrome (pyogenic arthritis, pyoderma gangrenosum, and acne). Given its significant biological functions and implications in disease, researchers have turned to recombinant protein technology to study PSTPIP1 in detail. Producing PSTPIP1 as a recombinant protein enables scientists to investigate its structural properties, functional roles, and interactions with other proteins in vitro. This approach provides valuable insights into the mechanisms by which PSTPIP1 contributes to cellular dynamics and disease pathology. Understanding the structure-function relationship of PSTPIP1 can pave the way for potential therapeutic strategies targeting autoinflammatory diseases or other related conditions, highlighting the necessity of ongoing research in this field.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US