Analytical Data
-
Gene name
PSMG4
- Application
-
Alternative Names
PSMG4;C6orf86;PAC4;Proteasome assembly chaperone 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JS54
-
Expression Region
1-123aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEGLVVAAGGDVSLHNFSARLWEQLVHFHV MRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLA QRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMG4, or Proteasome-Associated Protein 4, is a pivotal component of the 26S proteasome complex, which plays a crucial role in the degradation of ubiquitinated proteins within cells. This protein is involved in various cellular processes, including the regulation of the cell cycle, apoptosis, and the response to oxidative stress. Recent studies have highlighted the significance of PSMG4 in cancer biology, as its overexpression has been correlated with tumor progression and poor prognosis in several malignancies. This has sparked interest in investigating PSMG4 as a potential biomarker for cancer diagnosis and a therapeutic target. Furthermore, research into the structural and functional aspects of PSMG4 has revealed its interactions with other proteasomal subunits and regulatory factors, providing insights into its role in maintaining proteostasis. Understanding the molecular mechanisms by which PSMG4 contributes to proteasome function and cellular homeostasis could pave the way for novel therapeutic strategies aimed at modulating its activity in diseases characterized by dysregulated proteolysis, particularly in cancer. Thus, the study of PSMG4 and its recombinant protein forms is of paramount importance for elucidating its biological functions and potential applications in treating proteasome-related disorders.
