Analytical Data
-
Gene name
MRPS21
- Application
-
Alternative Names
MRP-S21;S21mt;Mitochondrial small ribosomal subunit protein bS21m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P82921
-
Expression Region
1-87 aa
-
AA Sequence
MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
-
Molecular Weight
37.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS21, or mitochondrial ribosomal protein S21, is a crucial component of the mitochondrial ribosome, playing a significant role in mitochondrial protein synthesis, which is essential for normal cellular function and energy metabolism. Research has shown that MRPS21 is involved in the assembly and stability of the mitochondrial ribosome, thereby influencing the translation of mitochondrial-encoded genes. Aberrations in MRPS21 expression or function can lead to mitochondrial dysfunction, which is implicated in a variety of diseases, including neurodegenerative disorders, diabetes, and certain types of cancer. Studies have increasingly focused on understanding the regulatory mechanisms and pathways involving MRPS21 to explore its potential as a therapeutic target. Additionally, its role in the coordination between nuclear and mitochondrial gene expression highlights its importance in the maintenance of cellular homeostasis. Given the critical nature of mitochondrial function in health and disease, MRPS21 stands out as a key area of investigation, with ongoing research aimed at elucidating its structural features, functional roles, and potential implications for disease intervention.











