Analytical Data
-
Gene name
Clusterin alpha chain
- Application
-
Alternative Names
Clusterin alpha chain；APOJ；CLI；KUB1；Clusterin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10909
-
Expression Region
23-224aa
-
AA Sequence
DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR
-
Molecular Weight
27.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Clusterin alpha chain, also known as Clusterin or ApoJ, is a multifunctional glycoprotein that plays a significant role in various biological processes, including apoptosis, inflammation, and lipid transport. It exists in two main forms: the secreted form, which is found in body fluids, and the intracellular form, associated with cellular functions. Research has demonstrated that Clusterin is involved in several pathological conditions, such as neurodegenerative diseases, cancer, and cardiovascular disorders, making it a target of interest for therapeutic interventions. The recombinant production of the Clusterin alpha chain protein enables researchers to study its structure, function, and interactions in greater detail. By generating recombinant proteins, scientists can explore the mechanism of action of Clusterin in cellular pathways and its potential as a biomarker or therapeutic target. This research is crucial for understanding the complex roles of Clusterin in health and disease, as well as for developing novel therapeutic strategies that harness its properties for disease modification and treatment.
