Cat: PA1000-2566

Recombinant Human PSMD5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMD5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMD5;KIAA0072;26S proteasome non-ATPase regulatory subunit 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16401

  • Expression Region

    1-504aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEFMAAQALALLREVARLEAPLEELRAL HSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAM EPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAE LLKQIVYCIGGENLSVAKAAIKSLSRISLTQAGLEALFESNLLDDLKSVM KTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRA TCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVK FFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSN VEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQ QTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQP WAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGN PNYLRLRTYLSEGPYYVKPVSTTAVEGAE

  • Molecular Weight

    59 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMD5 is a pivotal component of the 26S proteasome, a multi-subunit protease complex responsible for protein degradation in eukaryotic cells. The proteasome plays a crucial role in regulating various cellular processes, including the cell cycle, signal transduction, and apoptosis, by ensuring the controlled degradation of misfolded, damaged, or unneeded proteins. PSMD5, specifically, functions as a non-ATPase regulatory subunit and is involved in the recognition and translocation of ubiquitinated substrates into the proteolytic core of the proteasome. Emerging research highlights the importance of PSMD5 in various diseases, particularly cancer, where its expression levels can influence tumor progression and therapeutic responses. Additionally, altered PSMD5 activity has been implicated in neurodegenerative disorders, underscoring its significance in maintaining cellular homeostasis. Recent studies also suggest potential therapeutic strategies targeting the PSMD5 pathway, aiming to enhance proteasomal activity or inhibit specific interactions critical for disease progression. Understanding the structural and functional aspects of PSMD5, along with its regulatory mechanisms, can pave the way for novel interventions in diseases associated with proteasome dysfunction. Thus, the study of PSMD5 not only provides insights into fundamental cellular processes but also opens avenues for developing targeted therapies in oncology and other diseases characterized by protein homeostasis disruptions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US