Cat: PA1000-2551

Recombinant Human PSMA6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMA6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMA6;PROS27;Proteasome subunit alpha type-6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60900

  • Expression Region

    1-246aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMSRGSSAGFDRHITIFSPEGRLYQVE YAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENI GCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYT QNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTEST SFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPK FRILTEAEIDAHLVALAERD

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMA6, a vital component of the 26S proteasome, plays a crucial role in protein degradation and cellular regulation. This protein is part of the proteasome's catalytic core, specifically influencing the degradation of ubiquitinated substrates, which is essential for various cellular processes, including the cell cycle, apoptosis, and the regulation of signaling pathways. Dysregulation of proteasomal activity, including that involving PSMA6, has been implicated in a range of diseases, particularly cancers and neurodegenerative disorders. Recent studies have highlighted the potential of PSMA6 as a biomarker for certain malignancies, as well as its role in the immune response. Furthermore, the recombinant expression of PSMA6 provides an opportunity to explore its functional properties and interactions with other proteasomal subunits and substrates. By studying the recombination and characterization of PSMA6, researchers aim to better understand its mechanisms of action and potential therapeutic applications, paving the way for new strategies in drug design and disease management targeting proteasomal dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US