Analytical Data
-
Gene name
Prss28
- Application
-
Alternative Names
Prss28;Isp1;Serine protease 28
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q924N9
-
Expression Region
27-274aa
-
AA Sequence
KPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAA HCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLA LMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPY QLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGD SGGPLVCWKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHIQLE HHHHHH
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Prss28, a serine protease, is part of the larger family of serine peptidases that play crucial roles in various biological processes, including cell signaling, immune response, and developmental regulation. Emerging research highlights its potential involvement in reproductive biology, particularly in oocyte maturation and fertilization processes in mammals. The interest in Prss28 has escalated due to its expression in specific tissues, such as the ovary, suggesting its functional importance in reproductive health and fertility. Additionally, studies have demonstrated that Prss28 may influence the extracellular matrix composition and contribute to the regulation of cell behavior during developmental stages. Understanding the molecular mechanisms and biological pathways associated with Prss28 can shed light on its role in normal physiology and its implications in reproductive disorders. Characterizing recombinant Prss28 protein provides a valuable tool for elucidating its function, facilitating investigations into its enzymatic activity and interactions with other proteins. As research progresses, insights gained from Prss28 studies could pave the way for novel therapeutic approaches to address fertility issues and improve assisted reproductive technologies. Overall, the exploration of Prss28 as a recombinant protein represents a promising area of inquiry in both basic and applied biological sciences.
