Analytical Data
-
Gene name
CYP2A13
- Application
-
Alternative Names
CYP2A13；Cytochrome P450 2A13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16696
-
Expression Region
1-494aa
-
AA Sequence
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR
-
Molecular Weight
64.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP2A13 is a member of the cytochrome P450 superfamily of enzymes, primarily involved in the metabolism of various endogenous and exogenous compounds, including drugs and carcinogens. This enzyme is predominantly expressed in the human respiratory system, particularly in bronchial epithelial cells, which makes it crucial for studying the metabolic activation of tobacco-specific nitrosamines that are implicated in lung cancer. Given the rising incidence of smoking-related diseases, the role of CYP2A13 in detoxifying or bioactivating harmful substances has garnered significant research interest. Understanding CYP2A13's structure, function, and regulation can provide insights into individual variability in drug responses and susceptibility to lung cancer, particularly among smokers. Moreover, CYP2A13 has been shown to exhibit different activity levels among various populations due to genetic polymorphisms, impacting how different individuals metabolize carcinogens. Researchers are focusing on producing recombinant CYP2A13 proteins to study their enzymatic activity, substrate specificity, and inhibitor interactions, facilitating the development of better therapeutic strategies and risk assessments for tobacco-related diseases. The findings related to CYP2A13 can potentially inform personalized medicine approaches and contribute to reducing the impact of tobacco use on public health.
