Analytical Data
-
Gene name
PTGES3
- Application
-
Alternative Names
HSP90AA1;HSP90A;HSPC1;HSPCA;Heat shock Protein HSP 90-alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15185
-
Expression Region
1-160aa
-
AA Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
-
Molecular Weight
20.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTGES3, also known as prostaglandin E synthase 3, is a key enzyme involved in the biosynthesis of prostaglandins, which are critical lipid mediators that have a wide array of physiological and pathological roles. The protein is of particular interest due to its implications in inflammation, immune responses, and various diseases, including cancer. Elevated levels of PTGES3 have been observed in several malignancies, suggesting its potential as a biomarker and therapeutic target. Research efforts have aimed at understanding its enzymatic mechanisms, regulation, and the pathways it influences. Furthermore, PTGES3's role in modulating the tumor microenvironment highlights its significance in cancer progression and metastasis. Studies have demonstrated that the inhibition of PTGES3 can lead to reduced tumor growth and improved responses to certain therapies, underscoring the necessity for further exploration of this enzyme. As researchers delve deeper into PTGES3's structure-function relationship, the development of specific inhibitors and modulators could pave new avenues for targeted therapies in oncology and beyond, making it a focal point of contemporary biomedical research.











