Analytical Data
-
Gene name
CYP4F8
- Application
-
Alternative Names
CYP4F8；Cytochrome P450 4F8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98187
-
Expression Region
38-520aa
-
AA Sequence
TYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG
-
Molecular Weight
56.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP4F8, a member of the cytochrome P450 family, plays a crucial role in the metabolism of various endogenous and exogenous compounds, including fatty acids, steroids, and drugs. This enzyme is predominantly expressed in the liver and has garnered attention due to its involvement in biotransformation processes, influencing pharmacokinetics and pharmacodynamics of therapeutic agents. Research has shown that CYP4F8 is implicated in the metabolism of leukotrienes, which are mediators in inflammatory responses, making it a significant target for studying cardiovascular and inflammatory diseases. Additionally, variations in CYP4F8 expression and activity can contribute to interindividual differences in drug metabolism, potentially leading to variations in therapeutic efficacy and adverse drug reactions. Therefore, generating recombinant CYP4F8 proteins has become pivotal for understanding its biochemical properties, substrate specificity, and regulatory mechanisms. This research not only enhances our comprehension of drug metabolism pathways but also paves the way for developing personalized medicine approaches and improving the safety and efficacy of pharmacotherapy. The study of CYP4F8 through recombinant technology offers insights into its functional role in human health and disease, making it a valuable focus for future pharmacogenomic studies.
