Analytical Data
-
Gene name
CTSO
- Application
-
Alternative Names
CTSO;CTSO1;Cathepsin O
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43234
-
Expression Region
108-321aa
-
AA Sequence
LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
-
Molecular Weight
28.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSO, or Cathepsin O, is a lysosomal protease that plays a critical role in various physiological processes, including protein degradation, antigen processing, and apoptosis. Its dysregulation has been implicated in several diseases, including cancer and neurodegenerative disorders. Due to its significant biological functions, the study of CTSO and the development of recombinant CTSO proteins have garnered increasing attention in the biomedical research community. Researchers aim to understand its structure, function, and the mechanisms underlying its involvement in disease pathways. The recombinant production of CTSO allows for detailed investigations into its enzymatic activity and potential therapeutic applications. Additionally, studying CTSO provides insights into lysosomal biology and may lead to novel strategies for drug development and disease treatment. The ongoing research focuses on optimizing expression systems for CTSO production, characterizing its biochemical properties, and exploring its interactions with other cellular components. This knowledge could facilitate the design of specific inhibitors or modulators of CTSO, potentially paving the way for innovative therapeutic approaches in treating conditions associated with its dysfunction.











