Cat: PA2000-5235

Recombinant Human CIS3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CIS3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CIS3;C1orf7;CIAS1;NALP3;NACHT. LRR and PYD domains-containing Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47001

  • Expression Region

    65-227aa

  • AA Sequence

    DVISQIGDGQVQATSAATAQATDSQAQATTTATPTSSEKISSSASKTSTNATSSSCATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC

  • Molecular Weight

    24.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CIS3, or cytokine-inducible SH2-containing protein 3, is a member of the CIS family of proteins that play critical roles in cellular signaling pathways, particularly in response to cytokines and growth factors. Researchers have been increasingly focused on CIS3 due to its involvement in regulating immune responses, hematopoiesis, and various signaling cascades related to cell proliferation and differentiation. The understanding of CIS3 has gained momentum with advances in molecular biology techniques, which have facilitated the study of its structure, function, and interactions with other signaling molecules. Significant interest in CIS3 arises from its potential implications in diseases such as cancer, autoimmune disorders, and inflammatory conditions, where dysregulation of cytokine signaling often contributes to pathogenesis. By investigating CIS3 recombinant proteins, scientists aim to unravel its precise mechanisms of action, explore its role in disease processes, and identify potential therapeutic targets. The development of recombinant forms of CIS3 allows for high-throughput studies and the possibility of designing novel cytokine-based therapeutics, which could lead to innovative treatment strategies for various conditions associated with cytokine signaling imbalances. Overall, the research on CIS3 recombinant proteins reflects a broader interest in cytokine signaling networks and their physiological and pathological implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US