Analytical Data
-
Gene name
MR1
- Application
-
Alternative Names
Major histocompatibility complex class I-related protein 1. MHC class I-related protein 1. Class I histocompatibility antigen-like protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q95460
-
Expression Region
201-300 aa
-
AA Sequence
TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MR1 (MHC class I-related molecule 1) is a non-classical major histocompatibility complex protein that plays a crucial role in the immune system, particularly in presenting vitamin B metabolites to MAIT (mucosal-associated invariant T) cells. These T cells are a unique subset of innate-like lymphocytes that bridge the innate and adaptive immune responses. MR1's primary function involves recognizing microbial-derived vitamin metabolites and initiating a rapid immune response, making it essential in the defense against various infections, especially those caused by bacteria. Given the rising interest in targeting MR1 for immunotherapies, researchers have been working to understand its structure, function, and the mechanisms by which it activates MAIT cells. Notably, MR1's ability to present antigens in a non-traditional manner distinguishes it from classical MHC molecules, thus opening new avenues for drug development and vaccine strategies. Furthermore, MR1 has been implicated in various diseases, including cancer and autoimmune disorders, suggesting that modulation of MR1 interactions may have therapeutic potential. The study of MR1 and its interactions not only enhances our understanding of immune evasion by pathogens but may also contribute to the development of novel immunotherapeutic approaches aimed at harnessing this unique immune pathway. As such, MR1 research stands at the forefront of immunology, with significant implications for improving human health through innovative therapies leveraging the immune system's mechanisms.
