Analytical Data
-
Gene name
PRKAB1
- Application
-
Alternative Names
PRKAB1;AMPK;5'-AMP-activated Protein kinase subunit beta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9R078
-
Expression Region
2-270aa
-
AA Sequence
GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
-
Molecular Weight
36.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKAB1, or Protein Kinase AMP-Activated Non-Catalytic Subunit Beta 1, is a critical component of the AMP-activated protein kinase (AMPK) complex, which plays a vital role in cellular energy homeostasis and glucose metabolism. The AMPK pathway is significantly involved in the regulation of several metabolic processes, including fatty acid oxidation, glycogen synthesis, and lipogenesis, making it a key target for therapeutic interventions in metabolic disorders such as obesity and type 2 diabetes. Research on PRKAB1 recombinant protein focuses on understanding its structural and functional properties, as well as its interaction with other subunits of the AMPK complex. Through the expression and purification of PRKAB1 in heterologous systems, scientists aim to elucidate its role within the AMPK signaling cascade and its impact on energy balance. Further studies on PRKAB1 may lead to the identification of novel drug targets and the development of AMPK modulators, potentially offering new avenues for the treatment of metabolic syndromes. Overall, the investigation of PRKAB1 and its recombinant form is fundamental to advancing our understanding of metabolic regulation and developing effective strategies for the management of related diseases.
