Analytical Data
-
Gene name
PRKAA1
- Application
-
Alternative Names
PRKAA1;AMPK1;5'-AMP-activated Protein kinase catalytic subunit alpha-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13131
-
Expression Region
1-279aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMRRLSSWRKMATAEKQKHDGRVKIGHY ILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQ NLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKES RRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSD GEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDD DHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHE WF
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKAA1, also known as AMP-activated protein kinase (AMPK) alpha-1, plays a pivotal role in cellular energy homeostasis and metabolism regulation. It is a key sensor of cellular energy status and is activated in response to increases in AMP or decreases in ATP levels. The reconstitution of PRKAA1 as a recombinant protein has garnered significant interest due to its potential therapeutic implications in metabolic disorders, obesity, and type 2 diabetes. Research has demonstrated that AMPK activation enhances glucose uptake, fatty acid oxidation, and mitochondrial biogenesis, making it a critical target for drug development. Moreover, dysregulation of AMPK signaling has been implicated in various diseases, including cancer and neurodegenerative disorders. Thus, recombinant PRKAA1 can serve as a valuable tool for elucidating the molecular mechanisms of AMPK activation, understanding its role in disease pathogenesis, and screening for small molecules that could modulate its activity. By employing techniques such as bacterial expression systems and advanced purification methods, researchers aim to produce high-quality PRKAA1 protein that can be utilized in various biochemical assays, including enzyme activity measurements, structural studies, and interaction analyses with potential drug candidates. The continued exploration of PRKAA1 and its associated pathways holds promise for the development of novel therapeutic strategies aimed at restoring metabolic balance and improving overall health outcomes.











