Analytical Data
-
Gene name
Synpr
- Application
-
Alternative Names
Synpr;Synaptoporin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBG9
-
Expression Region
1-265aa
-
AA Sequence
MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI
-
Molecular Weight
29kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Synpr, or Synaptic Protein, plays a crucial role in the functioning of synapses, the sites of communication between neurons. Recent research has focused on the significance of Synpr in neurobiology, especially its involvement in synaptic plasticity, which is fundamental for learning and memory. Dysregulation or mutations in Synpr have been linked to various neurological disorders, including schizophrenia, autism spectrum disorders, and Alzheimer's disease. Understanding the structure and function of Synpr, alongside its interactions with other synaptic proteins, is essential for elucidating the underlying mechanisms of these conditions. Advances in protein engineering and recombinant DNA technology have allowed researchers to produce Synpr in a controlled laboratory setting, facilitating detailed studies of its biophysical properties and biological functions. By utilizing techniques such as crystallography and cryo-electron microscopy, scientists are beginning to map its precise role in synaptic transmission and modulation. This research could pave the way for targeted therapeutic strategies aimed at enhancing synaptic function or rectifying the disturbances caused by Synpr-related pathologies. As a result, Synpr has emerged as a focal point in the ongoing quest to understand complex neural networks and the biological foundations of cognitive function.











