Analytical Data
-
Gene name
MOGAT1
- Application
-
Alternative Names
MOGAT1; DC2; DGAT2L1; 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Diacylglycerol O-acyltransferase candidate 2; hDC2; Diacylglycerol acyltransferase 2-like protein 1; Monoacylglycerol O-acyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PD6
-
Expression Region
1-334 aa
-
AA Sequence
MKVEFAPLNIQLARRLQTVAVLQWVLSFLTGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
-
Molecular Weight
63.69 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOGAT1 (monoacylglycerol O-acyltransferase 1) is an enzyme primarily involved in the metabolism of monoacylglycerols, which are important intermediates in lipid synthesis and degradation. Its role in catalyzing the conversion of monoacylglycerols to diacylglycerols is critical for maintaining lipid homeostasis and regulating energy metabolism. Dysregulation of MOGAT1 has been implicated in various metabolic disorders, including obesity, insulin resistance, and related complications. Given the rising incidence of metabolic diseases worldwide, research on MOGAT1 has gained momentum, highlighting its potential as a therapeutic target. The recombinant protein of MOGAT1 is extensively studied in vitro to elucidate its enzymatic mechanisms, substrate specificity, and regulatory pathways. These studies often involve expression systems such as yeast or mammalian cells to obtain functional MOGAT1 protein for biochemical assays and structural analyses. Understanding the properties and actions of MOGAT1 not only contributes to the fundamental knowledge of lipid metabolism but also offers insights into developing novel strategies for treating metabolic diseases. Thus, the investigation into MOGAT1 recombinant protein represents a significant area of research with implications for both basic biology and clinical applications.
