Cat: PA1000-2482

Recombinant Human PPM1F Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPM1F

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPM1F;KIAA0015;POPX2;Protein phosphatase 1F

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49593

  • Expression Region

    1-454aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSSGAPQKSSPMASGAEETPGFLDTLL QDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAA ALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQ SFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLP SFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDP EGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQV ILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRA IGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQS HLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGE GDPQAEGRRQDLPSSLPEPETQAPPRS

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPM1F (Protein Phosphatase, Mg2+/Mn2+ Dependent 1F) is a serine/threonine phosphatase that plays a crucial role in the regulation of various cellular processes, including cell cycle progression, apoptosis, and response to stress. The enzyme is known to dephosphorylate target proteins, thereby modulating their activity and function. Research has shown that PPM1F is involved in several signaling pathways, making it a significant player in cellular signaling networks. Abnormal expression or activity of PPM1F has been associated with various diseases, including cancer, where it can influence tumor development and progression. By studying recombinant PPM1F, researchers aim to better understand its biochemical properties and interactions with substrates, providing insights into its role in health and disease. Furthermore, the investigation of PPM1F's mechanism of action may uncover potential therapeutic targets for diseases associated with dysregulated phosphatase activity. Recombinant forms of this protein facilitate the study of its enzymatic activity, substrate specificity, and regulatory mechanisms, enabling the identification of novel pathways and the development of intervention strategies. This research also contributes to the broader understanding of phosphatase functions in cellular homeostasis and the intricate balance of phosphorylation/dephosphorylation processes critical for normal cellular functioning.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US