Analytical Data
-
Gene name
MMS19L
- Application
-
Alternative Names
hMMS19; homolog of yeast MMS19; MET18; MET18 homolog; MET18MMS19 nucleotide excision repair homolog (S. cerevisiae); mms19; MMS19 nucleotide excision repair protein homolog; MMS19 nucleotide excision repair. S. cerevisiae. homolog of; MMS19-like (MET18 homolog. S. cerevisiae); MMS19-like protein; MMS19_HUMAN; MMS19L
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96T76
-
Expression Region
1-293 aa
-
AA Sequence
MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
-
Molecular Weight
57.97 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MMS19L is a newly identified protein that has garnered attention in molecular biology due to its potential role in the DNA damage response and protein quality control mechanisms. Research indicates that MMS19L may be involved in regulating gene expression related to cellular stress responses, particularly under conditions that induce oxidative stress or DNA damage. Given that proper functioning of these pathways is critical for maintaining genomic stability, understanding the role of MMS19L could have significant implications for cancer research and therapy, as defects in DNA repair mechanisms are often linked to tumorigenesis. Additionally, MMS19L's involvement in the stability of certain protein complexes suggests it may play a crucial role in cellular processes beyond DNA repair, including cell cycle regulation and apoptosis. Investigating the molecular pathways associated with MMS19L could lead to the discovery of novel therapeutic targets and strategies for enhancing cellular resilience against various stressors. As such, ongoing studies aim to elucidate its mechanism of action and potential applications in health and disease contexts.
