Analytical Data
-
Gene name
MMD2
- Application
-
Alternative Names
MMD2; PAQR10; Monocyte to macrophage differentiation factor 2; Progestin and adipoQ receptor family member 10; Progestin and adipoQ receptor family member X
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IY49
-
Expression Region
1-270 aa
-
AA Sequence
MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLS DDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYA PWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPAR YKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWH LFVAFGAGTHYYAIWRYLYLPSTLQTKVSK
-
Molecular Weight
31.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MMD2, or mitochondrial outer membrane protein (MMD2), is a key player in the regulation of mitochondrial function and cellular metabolism. Research into MMD2 recombinant proteins has gained prominence due to their potential implications in understanding various mitochondrial diseases and metabolic disorders. MMD2 is known to interact with various cellular components, influencing processes such as apoptosis, oxidative stress response, and energy production. By producing recombinant MMD2 proteins, researchers aim to investigate its structure, function, and role in disease mechanisms, utilizing techniques such as crystallography and biochemical assays. Additionally, MMD2's involvement in signaling pathways may provide insights into therapeutic targets for conditions linked to mitochondrial dysfunction, such as neurodegenerative diseases and age-related disorders. The intricate relationship between MMD2 and mitochondrial dynamics positions it as a crucial subject of study, offering prospects for novel interventions and enhanced understanding of cellular bioenergetics. Overall, the research surrounding MMD2 recombinant proteins not only enriches our basic scientific knowledge but also holds promise for the development of innovative therapeutic strategies in the realm of mitochondrial medicine.
