Analytical Data
-
Gene name
ZMYM2
- Application
-
Alternative Names
ZMYM2;FIM;RAMP;ZNF198;Zinc finger MYM-type Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBW7
-
Expression Region
423-466aa
-
AA Sequence
SRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNC
-
Molecular Weight
31.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMYM2 (Zinc Finger MYM-Type Protein 2) is a member of the MYM-type zinc finger protein family, which plays critical roles in various biological processes, including transcription regulation, development, and DNA repair. Recent research has highlighted the significance of ZMYM2 in tumor biology, particularly its involvement in breast cancer, where it has been associated with chromosomal rearrangements and altered gene expression. The protein is known to function as a transcriptional co-regulator, interacting with other key transcription factors to modulate gene expression essential for cellular differentiation and proliferation. Furthermore, ZMYM2 has been implicated in the maintenance of genomic stability, suggesting that disruptions in its function may contribute to oncogenesis. The complexity of ZMYM2's interactions and its potential as a therapeutic target prompted investigations into its structural properties and functional dynamics through recombinant protein studies. Understanding the molecular mechanisms of ZMYM2 could provide insights into its role in cancer progression and may lead to novel strategies for cancer treatment. Current research efforts focus on characterizing ZMYM2's protein structure, elucidating its interaction networks, and exploring its biological functions in various cancer models, making it a promising candidate for further exploration in cancer biology.











