Cat: PA2000-9375

Recombinant Human MLCK Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MLCK

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    zgc:92755; atrial isoform; cmlc2; MGC92755; MLC-2a; MLC2a; MLCK; cardiac; MLRA_HUMAN; MYL2A; MYL7; Mylc2a; Myosin light chain 2a; Myosin light chain 7 regulatory; Myosin light polypeptide 7 regulatory; Myosin regulatory light chain 2; Myosin regulatory light chain 2 atrial isoform; Myosin regulatory light chain 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01449

  • Expression Region

    1-175 aa

  • AA Sequence

    MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

  • Molecular Weight

    46.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Myosin light chain kinase (MLCK) is a crucial enzyme that plays a significant role in cellular processes, particularly in muscle contraction and various signaling pathways. It phosphorylates the myosin light chain, which is essential for muscle contraction in both smooth and striated muscles, thereby regulating smooth muscle contraction and influencing cellular functions such as motility and contraction in non-muscle cells. The understanding of MLCK’s structure and function has important implications in various physiological and pathological conditions, including cardiovascular diseases, asthma, and cancer. Research on MLCK recombinant proteins has gained momentum as scientists strive to elucidate the intricate details of its mechanism of action, post-translational modifications, and interactions with various cellular partners. By producing and purifying MLCK as a recombinant protein, researchers aim to perform in-depth biochemical studies that can shed light on its regulatory mechanisms and potential therapeutic targets. Moreover, studies on MLCK variants and their effects on muscle function can provide insights into the development of muscle-related diseases and pave the way for novel interventions. Overall, the investigation of MLCK through recombinant protein technology is a promising avenue for developing a deeper understanding of its biological roles and therapeutic potential in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US