Cat: PA2000-5149

Recombinant Human PIEZO1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PIEZO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PIEZO1;FAM38A;KIAA0233;Piezo-type mechanosensitive ion channel component 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92508

  • Expression Region

    2198-2431aa

  • AA Sequence

    RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS

  • Molecular Weight

    33.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PIEZO1 is a mechanically activated ion channel that plays a crucial role in various physiological processes, including mechanotransduction, cellular signaling, and blood pressure regulation. As a member of the PIEZO family, PIEZO1 has garnered attention due to its involvement in mechanosensation in diverse cell types, such as endothelial cells, red blood cells, and sensory neurons. Mutations or dysregulation of PIEZO1 are linked to several pathologies, including hereditary xerocytosis and associated hemolytic anemia, thus highlighting its importance in human health. Given its significance, the recombinant expression and characterization of PIEZO1 are essential for understanding its structure-function relationship. Research on PIEZO1 recombinant protein aims to elucidate its biophysical properties, ion conductance mechanisms, and interactions with other cellular components. These studies provide insights into how PIEZO1 transduces mechanical stimuli into biochemical signals, offering potential therapeutic targets for diseases associated with mechanotransduction dysfunction. The advancement of techniques in protein expression systems, coupled with innovative biophysical methods, allows for in-depth investigations of PIEZO1's dynamics and function, paving the way for future drug discovery and therapeutic interventions. Overall, the study of PIEZO1 recombinant protein is vital for comprehensively understanding its role in both normal physiology and disease states, ultimately contributing to the development of new strategies for treating mechanotransduction-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US