Analytical Data
-
Gene name
PNP
- Application
-
Alternative Names
PNP;NP;Purine nucleoside phosphorylase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00491
-
Expression Region
1-289aa
-
AA Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
-
Molecular Weight
48.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PNP (Purine Nucleoside Phosphorylase) is an essential enzyme in the purine salvage pathway, playing a critical role in nucleotide metabolism by catalyzing the phosphorolysis of purine nucleosides to their corresponding bases and ribose-1-phosphate. Dysfunction of PNP can lead to severe immunodeficiency disorders, highlighting its importance in cellular physiology and immune function. Research on PNP recombinant proteins has gained momentum as scientists seek to elucidate its structure-function relationships, interaction with various ligands, and regulatory mechanisms. The ability to produce PNP in a recombinant form allows for detailed biochemical characterization and the development of potential therapeutic strategies, including enzyme replacement therapy for genetic deficiencies. Additionally, understanding the enzymatic activity of PNP and its implications in various pathological conditions, such as lymphoproliferative disorders and certain cancers, provides insights into its potential as a therapeutic target. Advances in protein expression systems, purification techniques, and structural biology have facilitated the comprehensive study of PNP, paving the way for innovative applications in drug development and medical research.
