Cat: PA2000-5125

Recombinant Human RAB12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB12;Ras-related Protein Rab-12

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6IQ22

  • Expression Region

    1-244aa

  • AA Sequence

    MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

  • Molecular Weight

    56.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

InlA, also known as internalin A, is a surface protein produced by the pathogenic bacterium Listeria monocytogenes, which is known for its ability to invade human cells and establish infections. This protein plays a crucial role in the bacterium’s pathogenesis by facilitating its entry into epithelial cells through interaction with the host’s E-cadherin, a key component of cell-cell adhesion. The study of InlA is of significant interest due to its implications for understanding infection mechanisms and developing therapeutic interventions. Research has shown that the binding affinity between InlA and E-cadherin is essential for Listeria's virulence, making it a potential target for vaccine development and antibody-based therapies. Furthermore, examining the structural and functional aspects of InlA can provide insights into the broader category of microbial pathogenesis, particularly in how pathogens exploit host cell machinery. Recent studies have employed techniques such as X-ray crystallography and mutagenesis to elucidate the molecular interactions involved, revealing potential sites for drug design. Given the increasing incidence of listeriosis, particularly in immunocompromised individuals and pregnant women, understanding the role of InlA is critical not only for microbiology but also for public health initiatives aimed at preventing foodborne diseases. Thus, ongoing research continues to focus on InlA, aiming to uncover its complete functional landscape and harness this knowledge for innovative therapeutic strategies against L. monocytogenes infections.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US