Cat: PA2000-5122

Recombinant Human GPR107 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPR107

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPR107;KIAA1624;LUSTR1;Protein GPR107

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5VW38

  • Expression Region

    40-263aa

  • AA Sequence

    RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLP

  • Molecular Weight

    32.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPR107 is a member of the G protein-coupled receptor (GPCR) family, which plays a crucial role in various physiological processes and signaling pathways. It was initially identified as a GPR107-like protein involved in regulating cell proliferation, differentiation, and immune responses. Recent studies have highlighted its significance in cancer biology, particularly in tumor progression and metastasis, suggesting that it may influence both tumor cell behavior and the tumor microenvironment. Additionally, GPR107 has garnered interest due to its potential role in metabolic diseases and neurological disorders, with emerging evidence pointing to its involvement in regulating energy homeostasis and neuronal signaling. The development of GPR107 recombinant proteins facilitates the exploration of its structure-function relationships and downstream signaling mechanisms, ultimately aiding in the identification of novel therapeutic targets. Investigations into GPR107's ligand binding properties and its interaction with various intracellular signaling partners are crucial for understanding its biological functions. Moreover, exploring the implications of GPR107 in drug discovery and its potential as a biomarker for certain diseases could provide valuable insights into developing therapeutic strategies. Thus, the research on GPR107 recombinant proteins is vital for elucidating the complexities of GPCR-mediated signaling and its various implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US