Analytical Data
-
Gene name
GPR107
- Application
-
Alternative Names
GPR107;KIAA1624;LUSTR1;Protein GPR107
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VW38
-
Expression Region
40-263aa
-
AA Sequence
RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLP
-
Molecular Weight
32.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR107 is a member of the G protein-coupled receptor (GPCR) family, which plays a crucial role in various physiological processes and signaling pathways. It was initially identified as a GPR107-like protein involved in regulating cell proliferation, differentiation, and immune responses. Recent studies have highlighted its significance in cancer biology, particularly in tumor progression and metastasis, suggesting that it may influence both tumor cell behavior and the tumor microenvironment. Additionally, GPR107 has garnered interest due to its potential role in metabolic diseases and neurological disorders, with emerging evidence pointing to its involvement in regulating energy homeostasis and neuronal signaling. The development of GPR107 recombinant proteins facilitates the exploration of its structure-function relationships and downstream signaling mechanisms, ultimately aiding in the identification of novel therapeutic targets. Investigations into GPR107's ligand binding properties and its interaction with various intracellular signaling partners are crucial for understanding its biological functions. Moreover, exploring the implications of GPR107 in drug discovery and its potential as a biomarker for certain diseases could provide valuable insights into developing therapeutic strategies. Thus, the research on GPR107 recombinant proteins is vital for elucidating the complexities of GPCR-mediated signaling and its various implications in health and disease.











