Analytical Data
-
Gene name
PI3
- Application
-
Alternative Names
PIK3R4;VPS15;Phosphoinositide 3-kinase regulatory subunit 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19957
-
Expression Region
61-117aa
-
AA Sequence
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
-
Molecular Weight
22.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Phosphoinositide 3-kinases (PI3Ks) play a crucial role in various cellular processes, including growth, proliferation, survival, and metabolism. Dysregulation of PI3K signaling is implicated in many diseases, particularly cancer, where aberrant activation contributes to oncogenesis and tumor progression. The study of recombinant PI3K proteins has gained prominence as researchers aim to elucidate their complex structures and functions, as well as to explore potential therapeutic targets. Recombinant protein technology allows for the production of PI3K isoforms, which can be used to investigate their biochemical properties, downstream signaling pathways, and interactions with other cellular molecules. Moreover, the generation of mutant forms of PI3K helps in understanding the mechanism by which alterations in these proteins lead to disease states. The insights gained from these investigations not only enhance our understanding of PI3K biology but also pave the way for the development of PI3K inhibitors, which are currently being explored in clinical trials for treating cancers and other disorders. Consequently, the characterization and manipulation of recombinant PI3K proteins are pivotal in advancing our knowledge of signal transduction mechanisms and in developing targeted therapeutics for various diseases.











