Analytical Data
-
Gene name
METT5D1
- Application
-
Alternative Names
12S rRNA N(4)-cytidine methyltransferase METTL15, 12S rRNA m4C methyltransferase, EC:2.1.1.-, Methyltransferase 5 domain-containing protein 1, Methyltransferase-like protein 15
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NJ78
-
Expression Region
1-212 aa
-
AA Sequence
MAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGSLDMRMDGGRSTGTCIYPKNIRGGEACQENRFSNCSGTQHLPHHQNPAACQHRCRSISSLCYLYTERLTTAIYPYCHQDFPGSSHICEQ
-
Molecular Weight
49.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
METT5D1 is a gene that encodes for a member of the methyltransferase-like family of proteins, which are involved in various biological processes, including RNA metabolism and gene regulation. Recent studies have indicated that METT5D1 plays a crucial role in tRNA methylation, an essential process for proper protein synthesis and cellular function. Dysregulation of this gene has been linked to various diseases, including cancer and neurodegenerative disorders, highlighting its importance in maintaining cellular homeostasis. The recombinant METT5D1 protein has been produced for functional studies to better understand its enzymatic mechanisms and interactions with RNA substrates. Researchers are particularly interested in characterizing its methyltransferase activity and identifying potential binding partners that could elucidate its role in cellular pathways. The investigation of METT5D1 not only contributes to our fundamental knowledge of RNA biology but also holds potential therapeutic implications, as targeting its function could offer new strategies for treating diseases associated with its dysregulation. Overall, the study of METT5D1 and its recombinant protein represents a promising avenue for advancing our understanding of molecular biology and developing innovative therapeutic approaches.
