Analytical Data
-
Gene name
ihfA
- Application
-
Alternative Names
ihfA；hid；himA；Integration host factor subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A6X7
-
Expression Region
2-99aa
-
AA Sequence
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE
-
Molecular Weight
18.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on the recombinant IHF (Integration Host Factor) protein, specifically ihfA, has garnered significant interest due to its critical role in bacterial gene regulation and DNA metabolism. IHF is a key architectural protein found in various bacteria, including Escherichia coli, where it facilitates the bending and looping of DNA, thereby influencing the transcriptional activity of numerous operons. Its involvement in processes such as site-specific recombination, transposition, and the initiation of replication underscores its importance in bacterial physiology and adaptability. Advances in molecular biology techniques have enabled the expression of ihfA in heterologous systems, providing insights into its structure and function. Understanding the mechanism by which IHF influences gene expression can illuminate bacterial survival strategies and potentially lead to the development of novel antibacterial targets. Moreover, research into recombinant IHF proteins has implications for biotechnology, including applications in synthetic biology and the design of regulatory circuits. By elucidating the functional dynamics of ihfA, scientists aim to harness this knowledge for both therapeutic and biotechnological innovations, making it a significant focus in microbiological and genetic research.
