Analytical Data
-
Gene name
PTPRZ
- Application
-
Alternative Names
PTPRZ；HTPZP2；PTPRZ；PTPRZ2；Receptor-type tyrosine-Protein phosphatase zeta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23471
-
Expression Region
36-300aa
-
AA Sequence
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
-
Molecular Weight
34.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPRZ (Protein Tyrosine Phosphatase Receptor Type Z) is a member of the receptor-type protein tyrosine phosphatases (RPTPs) family, which plays a crucial role in regulating various cellular processes, including cell growth, differentiation, and signaling pathways. Its involvement in neurodevelopment and nervous system function has garnered significant attention, particularly in the context of brain function and neurodegenerative diseases. Recent studies have indicated that PTPRZ is implicated in the regulation of neuronal glue proteins, influencing synaptic plasticity and neural repair mechanisms. Abnormal expression or function of PTPRZ has been associated with neurological disorders, such as schizophrenia and multiple sclerosis, highlighting its potential as a therapeutic target. Researchers have sought to understand the structure-activity relationship of PTPRZ through the development of recombinant proteins, allowing for in-depth analysis of its biochemical properties and signaling capabilities. These studies have shed light on the molecular mechanisms underlying its function and highlighted its role in mediating cell-cell interactions and modulating extracellular matrix components. Understanding the biological significance of PTPRZ is essential for developing innovative strategies for therapeutic interventions in neurodegenerative diseases and other disorders linked to its dysregulation.
