Cat: PA2000-5086

Recombinant Human gtfB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    gtfB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    gtfB;Glucosyltransferase-I

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08987

  • Expression Region

    426-597aa

  • AA Sequence

    WLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSDNDTPYLHDDGDNMINMDNKLRLSLLFSLAKPLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRDIIKAEINPNVVGYSFTMEEIKKAFEI

  • Molecular Weight

    26.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GtfB is a crucial protein primarily found in various Streptococcus species, notably Streptococcus mutans, which is a major contributor to dental caries. It plays a significant role in the synthesis of glucans from sucrose, facilitating biofilm formation on tooth surfaces. Understanding the structure and function of GtfB is vital for comprehending its role in caries development and microbial colonization in the oral cavity. Research has increasingly focused on the potential of GtfB as a target for preventive dentistry, with the aim of developing novel therapeutic strategies that can inhibit its activity, thereby preventing plaque formation and subsequent dental issues. Additionally, due to its enzymatic nature, the recombinant production of GtfB has become a valuable tool for studying its biochemical properties, interactions with other oral bacteria, and its impact on dental health. The investigation of GtfB not only provides insights into microbial ecology within the oral environment but also opens avenues for innovative approaches to combat oral diseases through targeted inhibition of glucan synthesis. The recombinant expression of GtfB also facilitates the exploration of its potential as a biomarker in dental diagnostics or its use in vaccine development against caries-causing pathogens. Overall, the study of GtfB and its recombinant protein forms continues to enhance our understanding of oral microbiology and offers promising directions for improving oral health interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US