Cat: PA1000-2365

Recombinant Human PGK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PGK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PGK1;PGKA;Phosphoglycerate kinase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00558

  • Expression Region

    1-417aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSLSNKLTLDKLDVKGKRVVMRVDFNVPMK NNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEP VAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEG KGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDK VNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTR AKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCC AKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PGK1, or Phosphoglycerate Kinase 1, plays a crucial role in the glycolytic pathway, catalyzing the conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate while transferring a phosphate group to ADP to form ATP. This enzyme is not only vital for energy metabolism but also serves as a key regulator of various cellular processes, including cell proliferation and apoptosis. Dysregulation of PGK1 has been implicated in various diseases, particularly cancer, where it exhibits aberrant expression patterns, contributing to the metabolic reprogramming typical of tumor cells. Research on recombinant PGK1 has advanced significantly, as scientists seek to obtain large quantities of the protein for structural and functional studies, aiming to elucidate its mechanism of action and potential as a therapeutic target. The development of recombinant PGK1 involves the use of various expression systems, such as bacterial or yeast platforms, allowing for the generation of active, purified protein suitable for in vitro assays and potential therapeutic applications. Understanding the biochemical properties and interactions of PGK1 in disease states can lead to novel insights into metabolic pathways and contribute to the development of targeted treatments, underscoring the importance of PGK1 in both fundamental research and clinical contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US