Cat: PA2000-800DB

Recombinant Human PTPRA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTPRA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PTPRA;PTPA;PTPRL2;Receptor-type tyrosine-Protein phosphatase alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P18433

  • Expression Region

    20-151aa

  • AA Sequence

    NNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETP

  • Molecular Weight

    15.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTPRA (Protein Tyrosine Phosphatase Receptor Type A) is a member of the protein tyrosine phosphatase family, which plays a crucial role in regulating various cellular processes, including cell growth, differentiation, and signaling pathways. Dysregulation of PTPRA has been implicated in various diseases, particularly cancer, where it may contribute to tumor progression and metastasis. The study of PTPRA recombinant proteins is essential for understanding its structure-function relationships and elucidating the molecular mechanisms behind its activity. Researchers have focused on producing recombinant PTPRA to facilitate in vitro studies that assess its enzymatic functions, interactions with substrates, and potential as a therapeutic target. By generating PTPRA in a controlled environment, scientists can investigate the effects of specific mutations, post-translational modifications, and other factors that influence its activity. Furthermore, understanding PTPRA's role in tumor biology could lead to the development of novel biomarkers and targeted therapies, making it a significant focus of ongoing cancer research. Through the expression and purification of PTPRA recombinant proteins, researchers aim to advance our knowledge of this phosphatase's functions and its implications in health and disease, thereby opening new avenues for therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US