Analytical Data
-
Gene name
MED31
- Application
-
Alternative Names
MED31, SOH1, CGI-125
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3C7
-
Expression Region
1-1313aa
-
AA Sequence
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
-
Molecular Weight
40.15 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MED31 is a subunit of the Mediator complex, a critical multisubunit coactivator that plays an essential role in the regulation of gene transcription. The Mediator complex acts as a bridge between transcription factors and RNA polymerase II, thereby influencing the transcriptional activation of genes in response to various signaling pathways. Research on MED31 has gained momentum due to its implications in various biological processes, including development, differentiation, and response to environmental stimuli. Abnormalities in the Mediator complex, including MED31, have been linked to various diseases, including cancer and genetic disorders, highlighting its importance in maintaining cellular homeostasis. Recent studies have focused on understanding the structural and functional characteristics of MED31, as well as its interactions with other Mediator subunits and transcription factors. Investigating MED31 as a recombinant protein allows scientists to explore its biochemical properties, elucidate its role in transcriptional regulation, and assess the potential for therapeutic interventions targeting the Mediator complex. Overall, the study of MED31 and its functions represents a vital area of research with significant implications for understanding gene expression regulation and its impact on health and disease.
