Cat: PA1000-2335

Recombinant Human PEDF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PEDF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SERPINF1;PEDF;Pigment epithelium-derived factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P36955

  • Expression Region

    20-418aa

  • AA Sequence

    QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVR SSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIH GTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVL TGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVT KFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLT GSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKL SYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGA GTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Pigment epithelium-derived factor (PEDF) is a unique serpin that has garnered significant attention in medical research due to its diverse biological roles, particularly in neuroprotection, anti-angiogenesis, and cancer inhibition. Initially discovered as a retinal pigment epithelium-secreted protein, PEDF plays a crucial role in the maintenance of retinal health and has been implicated in various ocular diseases such as diabetic retinopathy and age-related macular degeneration. Beyond ocular applications, PEDF is recognized for its neuroprotective properties, showing promise in protecting neuronal cells from degeneration due to oxidative stress and apoptosis. Research has also highlighted its anti-angiogenic effects, making it a potential therapeutic candidate for inhibiting pathological blood vessel formation in tumors and other diseases. Furthermore, studies investigating the recombinant production of PEDF protein have aimed to explore its functional mechanisms in numerous biological pathways, enabling better understanding and potential applications in regenerative medicine and cancer therapy. The development of effective recombinant PEDF has opened new avenues for therapeutic intervention, making it an attractive focus of research in pharmacology and biotechnology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US