Analytical Data
-
Gene name
PEA15
- Application
-
Alternative Names
PEA15;Astrocytic phosphoProtein PEA-15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15121
-
Expression Region
1-130aa
-
AA Sequence
GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFS FLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDT KLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PEA15 (Phosphoprotein Enriched in Astrocytes 15) is a multifunctional protein primarily expressed in astrocytes and neurons, known for its roles in regulating cell signaling and apoptosis. Research suggests that PEA15 may play a significant role in neurological disorders, including neurodegenerative diseases like Alzheimer's and other conditions marked by aberrant cell growth or survival. The protein functions as a scaffold, interacting with various signaling pathways, including those mediated by the extracellular signal-regulated kinases (ERKs). PEA15 is distinguished by its ability to sequester ERK1/2, preventing their translocation to the nucleus and thereby inhibiting downstream signaling that promotes cell proliferation and survival. Furthermore, PEA15 has been implicated in the modulation of inflammatory responses in the brain, highlighting its potential as a therapeutic target in neuroinflammatory disorders. Given the critical roles of PEA15 in cellular regulation and neuroprotection, the recombinant expression and purification of this protein have become essential for further studies. Researchers aim to elucidate its molecular mechanisms, potential interactions with other cellular proteins, and influence on cellular processes. Enhanced understanding of PEA15's structure and function may pave the way for new therapeutic strategies targeting PEA15-related pathways, ultimately contributing to the development of novel treatments for various neurological diseases. As studies continue to unveil the intricacies of PEA15's role within neuronal contexts, it stands as a pivotal protein warranting extensive investigation in both basic and applied neuroscience research.











