Analytical Data
-
Gene name
patZ
- Application
-
Alternative Names
patZ;PATZ;RIAZ;ZBTB19;POZ-. AT hook-. and zinc finger-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P76594
-
Expression Region
724-886aa
-
AA Sequence
ERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMAFVAVRRIDQTEEILGVTRAISDPDNIDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNVDIQLEEGIVGLTLNLAQREES
-
Molecular Weight
26.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PatZ is a protein that has garnered interest in the field of synthetic biology and biochemistry due to its role in the regulation of filamentous actin dynamics in cells. The protein is derived from bacterial systems, where it functions as a regulator of actin polymerization, thus influencing various cellular processes, including motility, shape, and division. Research on PatZ aims to understand its underlying mechanisms, structure-function relationships, and potential applications in biotechnology and medicine. By elucidating how PatZ interacts with other proteins and its effects on actin filament stability, scientists seek to harness its properties for innovative solutions in drug delivery, tissue engineering, and the development of targeted therapies for diseases characterized by aberrant actin dynamics. Additionally, PatZ serves as a valuable model for studying actin-related processes and can assist in the design of synthetic networks that mimic natural cellular functions. The exploration of PatZ and its variants not only enhances our comprehension of fundamental biological processes but also paves the way for technological advancements in the application of synthetic biology in health and industry. Consequently, understanding PatZ and its mechanisms offers promising avenues for therapeutic interventions and the engineering of novel biomaterials.











