Cat: PA2000-5048

Recombinant Human patZ Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    patZ

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    patZ;PATZ;RIAZ;ZBTB19;POZ-. AT hook-. and zinc finger-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P76594

  • Expression Region

    724-886aa

  • AA Sequence

    ERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMAFVAVRRIDQTEEILGVTRAISDPDNIDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNVDIQLEEGIVGLTLNLAQREES

  • Molecular Weight

    26.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PatZ is a protein that has garnered interest in the field of synthetic biology and biochemistry due to its role in the regulation of filamentous actin dynamics in cells. The protein is derived from bacterial systems, where it functions as a regulator of actin polymerization, thus influencing various cellular processes, including motility, shape, and division. Research on PatZ aims to understand its underlying mechanisms, structure-function relationships, and potential applications in biotechnology and medicine. By elucidating how PatZ interacts with other proteins and its effects on actin filament stability, scientists seek to harness its properties for innovative solutions in drug delivery, tissue engineering, and the development of targeted therapies for diseases characterized by aberrant actin dynamics. Additionally, PatZ serves as a valuable model for studying actin-related processes and can assist in the design of synthetic networks that mimic natural cellular functions. The exploration of PatZ and its variants not only enhances our comprehension of fundamental biological processes but also paves the way for technological advancements in the application of synthetic biology in health and industry. Consequently, understanding PatZ and its mechanisms offers promising avenues for therapeutic interventions and the engineering of novel biomaterials.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US