Cat: PA1000-2325

Recombinant Human PDXK Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDXK

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PDXK;C21orf124;C21orf97;PKH;Pyridoxal kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00764

  • Expression Region

    1-312aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATF PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK YDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSM YVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLH SMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKV DAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKA QAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PDXK (pyridoxal kinase) is an essential enzyme that catalyzes the phosphorylation of pyridoxal to pyridoxal-5'-phosphate (PLP), the active form of vitamin B6, which is crucial for numerous biological processes, including amino acid metabolism, neurotransmitter synthesis, and enzymatic reactions. Given its pivotal role in cellular metabolism and the potential implications of vitamin B6 deficiency in various health conditions, including neurological disorders and immune system dysfunction, the study of PDXK has garnered significant attention in recent years. The recombinant expression of PDXK allows for in-depth investigations into its enzymatic properties, structural characteristics, and regulatory mechanisms. This research not only enhances our understanding of the enzyme's function but also paves the way for the development of therapeutic strategies targeting PDXK-related pathways. Furthermore, characterizing the recombinant PDXK protein can facilitate the discovery of novel inhibitors or activators, which may have implications in treating vitamin B6-related disorders or optimizing metabolic pathways in various organisms. Thus, the study of recombinant PDXK stands at the intersection of biochemistry, health sciences, and therapeutic development, underscoring its importance in both fundamental research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US