Analytical Data
-
Gene name
SCP2
- Application
-
Alternative Names
SCP2；SCP2；Synaptonemal complex Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22307
-
Expression Region
1-143aa
-
AA Sequence
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
-
Molecular Weight
42.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCP2, or Steroid Carrier Protein 2, is a crucial protein involved in the transport and metabolism of sterols and lipids within cells. Research into SCP2 has garnered attention due to its significant role in various physiological processes, including cholesterol homeostasis and steroidogenesis. Abnormalities in SCP2 function have been implicated in several metabolic disorders and diseases, such as diabetes, cardiovascular diseases, and certain types of cancer. Understanding the structure and function of SCP2 is vital for deciphering its biological roles and therapeutic potential. Recent studies have focused on the recombinant expression of SCP2, allowing for the production of large quantities of the protein for functional assays and structural analysis. This approach facilitates the exploration of SCP2's interactions with other biomolecules, its regulatory mechanisms, and its potential as a drug target. By elucidating the molecular mechanisms underlying SCP2's function, researchers aim to enhance our understanding of lipid metabolism and identify new strategies for treating related diseases. Overall, the study of recombinant SCP2 represents a promising avenue for advancing knowledge in lipid biochemistry and developing innovative therapeutic interventions.
