Analytical Data
-
Gene name
MBD5
- Application
-
Alternative Names
9430004D19Rik; AA536666; AI426407; C030040A15Rik; FLJ11113; FLJ30517; KIAA1461 ; MBD5; MBD5_HUMAN; methyl CpG binding domain protein 5; Methyl CpG binding protein MBD5 ; Methyl-CpG-binding domain protein 5; Methyl-CpG-binding protein MBD5; RP23 167N13.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P267
-
Expression Region
1-229aa
-
AA Sequence
MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
-
Molecular Weight
50.93 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBD5 (Methyl-CpG Binding Domain Protein 5) is a member of the MBD family of proteins, which are known for their roles in recognizing and binding to methylated DNA, thus playing a crucial role in gene regulation and epigenetic modifications. Research on MBD5 has gained prominence due to its association with neurodevelopmental disorders, particularly the 2q23.1 deletion syndrome, which implicates MBD5 as a significant player in cognitive functions and developmental processes. Mutations or disruptions in MBD5 have been linked to various phenotypic manifestations, including intellectual disabilities, speech delays, and other neurobehavioral issues. Given the importance of MBD5 in the regulation of gene expression and its potential implications in disease, researchers are focused on characterizing the structure and function of MBD5 through recombinant protein studies. These investigations aim to elucidate the protein's binding affinities, interaction partners, and downstream effects on gene expression. By analyzing the recombinant MBD5 protein, scientists hope to uncover insights into its biological mechanisms and how dysregulation contributes to pathologies, thereby paving the way for potential therapeutic strategies targeting MBD5-related disorders. Furthermore, understanding MBD5's role in methylation dynamics can enhance our knowledge of epigenetic regulation in broader contexts, potentially influencing fields ranging from developmental biology to cancer research.
